Lineage for d3itda_ (3itd A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1831011Species Cochliobolus lunatus [TaxId:5503] [225937] (9 PDB entries)
  8. 1831021Domain d3itda_: 3itd A: [211941]
    automated match to d3uvea_
    complexed with cl, gol

Details for d3itda_

PDB Entry: 3itd (more details), 1.89 Å

PDB Description: crystal structure of an inactive 17beta-hydroxysteroid dehydrogenase (y167f mutated form) from fungus cochliobolus lunatus
PDB Compounds: (A:) 17beta-hydroxysteroid dehydrogenase

SCOPe Domain Sequences for d3itda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3itda_ c.2.1.0 (A:) automated matches {Cochliobolus lunatus [TaxId: 5503]}
yipgrldgkvalvtgsgrgigaavavhlgrlgakvvvnyanstkdaekvvseikalgsda
iaikadirqvpeivklfdqavahfghldiavsnsgvvsfghlkdvteeefdrvfslntrg
qffvareayrhlteggrivltssntskdfsvpkhslfsgskgavdsfvrifskdcgdkki
tvnavapggtvtdmfhevshhyipngtsytaeqrqqmaahasplhrngwpqdvanvvgfl
vskegewvngkvltldggaa

SCOPe Domain Coordinates for d3itda_:

Click to download the PDB-style file with coordinates for d3itda_.
(The format of our PDB-style files is described here.)

Timeline for d3itda_: