Lineage for d2hrpl2 (2hrp L:108-211)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104205Species Fab F11.2.32 (mouse), kappa L chain [49049] (2 PDB entries)
  8. 104207Domain d2hrpl2: 2hrp L:108-211 [21194]
    Other proteins in same PDB: d2hrph1, d2hrpl1, d2hrpm1, d2hrpn1

Details for d2hrpl2

PDB Entry: 2hrp (more details), 2.2 Å

PDB Description: antigen-antibody complex

SCOP Domain Sequences for d2hrpl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hrpl2 b.1.1.2 (L:108-211) Immunoglobulin (constant domains of L and H chains) {Fab F11.2.32 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d2hrpl2:

Click to download the PDB-style file with coordinates for d2hrpl2.
(The format of our PDB-style files is described here.)

Timeline for d2hrpl2: