Lineage for d1hyyh2 (1hyy H:114-215)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221327Species Fab 6D9 (mouse), kappa L chain [49048] (2 PDB entries)
    hydrolytic antibody
  8. 221330Domain d1hyyh2: 1hyy H:114-215 [21193]
    Other proteins in same PDB: d1hyyh1, d1hyyl1
    complexed with cpd

Details for d1hyyh2

PDB Entry: 1hyy (more details), 1.8 Å

PDB Description: crystal form ii: high resolution crystal structure of the complex of the hydrolytic antibody fab 6d9 and a transition-state analog

SCOP Domain Sequences for d1hyyh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hyyh2 b.1.1.2 (H:114-215) Immunoglobulin (constant domains of L and H chains) {Fab 6D9 (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc

SCOP Domain Coordinates for d1hyyh2:

Click to download the PDB-style file with coordinates for d1hyyh2.
(The format of our PDB-style files is described here.)

Timeline for d1hyyh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hyyh1