SCOP 1.59: Domain d1hyyh2: 1hyy H:114-215

Lineage for d1hyyh2 (1hyy H:114-215)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)

7. Species Fab 6D9 (mouse), kappa L chain [49048] (2 PDB entries)

8. Domain d1hyyh2: 1hyy H:114-215 [21193]
   Other proteins in same PDB: d1hyyh1, d1hyyl1

Details for d1hyyh2

PDB Entry: 1hyy, 1.8 Å

PDB Description: crystal form ii: high resolution crystal structure of the complex of the hydrolytic antibody fab 6d9 and a transition-state analog

SCOP Domain Sequences for d1hyyh2:

Sequence; same for both SEQRES and ATOM records:

>d1hyyh2 b.1.1.2 (H:114-215) Immunoglobulin (constant domains of L and H chains) {Fab 6D9 (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc

Timeline for d1hyyh2:

• d1hyyh2 first appeared (with stable ids) in SCOP 1.55
  
• d1hyyh2 appears in SCOP 1.57
  
• d1hyyh2 appears in SCOP 1.61
  
• d1hyyh2 last appears in SCOP 1.73