Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species) |
Species Fab 6D9 (mouse), kappa L chain [49048] (2 PDB entries) |
Domain d1hyxh2: 1hyx H:114-215 [21191] Other proteins in same PDB: d1hyxh1, d1hyxl1 |
PDB Entry: 1hyx (more details), 1.8 Å
SCOP Domain Sequences for d1hyxh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hyxh2 b.1.1.2 (H:114-215) Immunoglobulin (constant domains of L and H chains) {Fab 6D9 (mouse), kappa L chain} akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
Timeline for d1hyxh2: