SCOP 1.57: Domain d1hyxl2: 1hyx L:108-211

Lineage for d1hyxl2 (1hyx L:108-211)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)

7. Species Fab 6D9 (mouse), kappa L chain [49048] (2 PDB entries)

8. Domain d1hyxl2: 1hyx L:108-211 [21190]
   Other proteins in same PDB: d1hyxh1, d1hyxl1

Details for d1hyxl2

PDB Entry: 1hyx, 1.8 Å

PDB Description: high resolution crystal structure of the complex of the hydrolytic antibody fab 6d9 and a transition-state analog

SCOP Domain Sequences for d1hyxl2:

Sequence; same for both SEQRES and ATOM records:

>d1hyxl2 b.1.1.2 (L:108-211) Immunoglobulin (constant domains of L and H chains) {Fab 6D9 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d1hyxl2:

• d1hyxl2 first appeared (with stable ids) in SCOP 1.55
  
• d1hyxl2 appears in SCOP 1.59
  
• d1hyxl2 last appears in SCOP 1.73