![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
![]() | Species Fab D2.5 (mouse), kappa L chain [49047] (4 PDB entries) |
![]() | Domain d1yehl2: 1yeh L:108-214 [21188] Other proteins in same PDB: d1yehh1, d1yehl1 |
PDB Entry: 1yeh (more details), 2.55 Å
SCOP Domain Sequences for d1yehl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yehl2 b.1.1.2 (L:108-214) Immunoglobulin (constant domains of L and H chains) {Fab D2.5 (mouse), kappa L chain} rgdaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1yehl2: