Lineage for d3is4b2 (3is4 B:88-186)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1551526Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 1551527Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 1551528Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
    this domain interrupts beta/alpha-barrel domain
    C-terminal domain is alpha/beta
  6. 1551529Protein Pyruvate kinase (PK) [50802] (6 species)
  7. 1551617Species Trypanosome (Leishmania mexicana) [TaxId:5665] [50805] (11 PDB entries)
  8. 1551623Domain d3is4b2: 3is4 B:88-186 [211867]
    Other proteins in same PDB: d3is4a1, d3is4a3, d3is4b1, d3is4b3
    automated match to d1pkla1
    complexed with gol, ptk

Details for d3is4b2

PDB Entry: 3is4 (more details), 2.1 Å

PDB Description: crystal structure of leishmania mexicana pyruvate kinase (lmpyk)in complex with 1,3,6,8-pyrenetetrasulfonic acid
PDB Compounds: (B:) pyruvate kinase

SCOPe Domain Sequences for d3is4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3is4b2 b.58.1.1 (B:88-186) Pyruvate kinase (PK) {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
eirtgqfvggdavmergatcyvttdpafadkgtkdkfyidyqnlskvvrpgnyiyiddgi
lilqvqshedeqtlectvtnshtisdrrgvnlpgcdvdl

SCOPe Domain Coordinates for d3is4b2:

Click to download the PDB-style file with coordinates for d3is4b2.
(The format of our PDB-style files is described here.)

Timeline for d3is4b2: