SCOP 1.59: Domain d1yeel2: 1yee L:108-214

Lineage for d1yeel2 (1yee L:108-214)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)

7. Species Fab D2.5 (mouse), kappa L chain [49047] (4 PDB entries)

8. Domain d1yeel2: 1yee L:108-214 [21186]
   Other proteins in same PDB: d1yeeh1, d1yeel1

Details for d1yeel2

PDB Entry: 1yee, 2.2 Å

PDB Description: structure of a catalytic antibody, igg2a fab fragment (d2.5)

SCOP Domain Sequences for d1yeel2:

Sequence; same for both SEQRES and ATOM records:

>d1yeel2 b.1.1.2 (L:108-214) Immunoglobulin (constant domains of L and H chains) {Fab D2.5 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1yeel2:

• d1yeel2 first appeared (with stable ids) in SCOP 1.55
  
• d1yeel2 appears in SCOP 1.57
  
• d1yeel2 appears in SCOP 1.61
  
• d1yeel2 appears in the current release, SCOPe 2.08