Lineage for d1yeel2 (1yee L:108-214)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8910Species Fab D2.5 (mouse), kappa L chain [49047] (4 PDB entries)
  8. 8916Domain d1yeel2: 1yee L:108-214 [21186]
    Other proteins in same PDB: d1yeeh1, d1yeel1

Details for d1yeel2

PDB Entry: 1yee (more details), 2.2 Å

PDB Description: structure of a catalytic antibody, igg2a fab fragment (d2.5)

SCOP Domain Sequences for d1yeel2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yeel2 b.1.1.2 (L:108-214) Immunoglobulin (constant domains of L and H chains) {Fab D2.5 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1yeel2:

Click to download the PDB-style file with coordinates for d1yeel2.
(The format of our PDB-style files is described here.)

Timeline for d1yeel2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yeel1