Lineage for d1yegh2 (1yeg H:114-223)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655437Domain d1yegh2: 1yeg H:114-223 [21185]
    Other proteins in same PDB: d1yegh1, d1yegl1, d1yegl2
    part of Fab D2.5
    complexed with act, bpn, zn

Details for d1yegh2

PDB Entry: 1yeg (more details), 2 Å

PDB Description: structure of igg2a fab fragment (d2.3) complexed with reaction product
PDB Compounds: (H:) igg2a fab fragment

SCOP Domain Sequences for d1yegh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yegh2 b.1.1.2 (H:114-223) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep

SCOP Domain Coordinates for d1yegh2:

Click to download the PDB-style file with coordinates for d1yegh2.
(The format of our PDB-style files is described here.)

Timeline for d1yegh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yegh1