SCOPe 2.08: Domain d3iq1c1: 3iq1 C:1-156

Lineage for d3iq1c1 (3iq1 C:1-156)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.0: automated matches [191307] (1 protein)
   not a true family

6. Protein automated matches [190036] (60 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:243277] [225741] (1 PDB entry)

8. Domain d3iq1c1: 3iq1 C:1-156 [211843]
   Other proteins in same PDB: d3iq1b2, d3iq1c2, d3iq1d2
   automated match to d1dpsa_
   complexed with cl

Details for d3iq1c1

PDB Entry: 3iq1, 1.67 Å

PDB Description: Crystal structure of DPS protein from Vibrio cholerae O1, a member of a broad superfamily of ferritin-like diiron-carboxylate proteins

PDB Compounds: (C:) Dps family protein

SCOPe Domain Sequences for d3iq1c1:

Sequence; same for both SEQRES and ATOM records:

>d3iq1c1 a.25.1.0 (C:1-156) automated matches {Vibrio cholerae [TaxId: 243277]}
matnligldttqsqklanalnnllanyqvfymntrgyhwniqgkeffelhakfeeiytdl
qlkidelaeriltlsarpmhsfsgylkaaqikehtdsidgrssmqglvdgfsillhqqrd
ilelagetgdegtsalmsdyireqeklvwmlnawlk

Timeline for d3iq1c1:

• d3iq1c1 first appeared in SCOPe 2.03, called d3iq1c_
  
• d3iq1c1 appears in SCOPe 2.07