SCOPe 2.06: Domain d3innc1: 3inn C:1-283

Lineage for d3innc1 (3inn C:1-283)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (50 species)
   not a true protein

7. Species Brucella melitensis [TaxId:29459] [225767] (1 PDB entry)

8. Domain d3innc1: 3inn C:1-283 [211824]
   Other proteins in same PDB: d3inna2, d3innb2, d3innc2, d3innd2
   automated match to d3mueb_
   complexed with atp, unx

Details for d3innc1

PDB Entry: 3inn, 2.1 Å

PDB Description: Crystal structure of pantoate-beta-alanine-ligase in complex with ATP at low occupancy at 2.1 A resolution

PDB Compounds: (C:) Pantothenate synthetase

SCOPe Domain Sequences for d3innc1:

Sequence; same for both SEQRES and ATOM records:

>d3innc1 c.26.1.0 (C:1-283) automated matches {Brucella melitensis [TaxId: 29459]}
mqiihtieelrqalaparqqgkkigfvptmgylhkghlelvrrarvendvtlvsifvnpl
qfganedlgryprdlerdagllhdaqvdylfaptvsdmyprpmqtvvdvpplgnqiegea
rpghfagvatvvsklfnivgpdaayfgekdfqqlviirrmvddmaipvrivgvetvredd
glacssrnvyltpeqrraaiivpqaldeadrlyrsgmddpdaleaairtfigrqplavpe
viairdpetlerlpalqgrpilvalfvrvgatrlldnrvigha

Timeline for d3innc1:

• d3innc1 first appeared in SCOPe 2.03, called d3innc_
  
• d3innc1 was called d3innc_ in SCOPe 2.05
  
• d3innc1 appears in SCOPe 2.07
  
• d3innc1 appears in the current release, SCOPe 2.08