SCOPe 2.03: Domain d3innc_: 3inn C:

Lineage for d3innc_ (3inn C:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (31 species)
   not a true protein

7. Species Brucella melitensis [TaxId:29459] [225767] (1 PDB entry)

8. Domain d3innc_: 3inn C: [211824]
   automated match to d3mueb_
   complexed with atp, unx

Details for d3innc_

PDB Entry: 3inn, 2.1 Å

PDB Description: Crystal structure of pantoate-beta-alanine-ligase in complex with ATP at low occupancy at 2.1 A resolution

PDB Compounds: (C:) Pantothenate synthetase

SCOPe Domain Sequences for d3innc_:

Sequence; same for both SEQRES and ATOM records:

>d3innc_ c.26.1.0 (C:) automated matches {Brucella melitensis [TaxId: 29459]}
smqiihtieelrqalaparqqgkkigfvptmgylhkghlelvrrarvendvtlvsifvnp
lqfganedlgryprdlerdagllhdaqvdylfaptvsdmyprpmqtvvdvpplgnqiege
arpghfagvatvvsklfnivgpdaayfgekdfqqlviirrmvddmaipvrivgvetvred
dglacssrnvyltpeqrraaiivpqaldeadrlyrsgmddpdaleaairtfigrqplavp
eviairdpetlerlpalqgrpilvalfvrvgatrlldnrvigha

Timeline for d3innc_:

• d3innc_ is new in SCOPe 2.03-stable
  
• d3innc_ appears in SCOPe 2.04
  
• d3innc_ appears in the current release, SCOPe 2.08, called d3innc1