SCOPe 2.03: Domain d3il9b2: 3il9 B:175-317

Lineage for d3il9b2 (3il9 B:175-317)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (40 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [225630] (7 PDB entries)

8. Domain d3il9b2: 3il9 B:175-317 [211816]
   automated match to d1mzja2

Details for d3il9b2

PDB Entry: 3il9, 1.85 Å

PDB Description: structure of e. coli fabh

PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase 3

SCOPe Domain Sequences for d3il9b2:

Sequence; same for both SEQRES and ATOM records:

>d3il9b2 c.95.1.0 (B:175-317) automated matches {Escherichia coli [TaxId: 83333]}
isthlhadgsygelltlpnadrvnpensihltmagnevfkvavtelahivdetlaannld
rsqldwlvphqanlriisatakklgmsmdnvvvtldrhgntsaasvpcaldeavrdgrik
pgqlvlleafgggftwgsalvrf

Timeline for d3il9b2:

• d3il9b2 is new in SCOPe 2.03-stable
  
• d3il9b2 appears in SCOPe 2.04
  
• d3il9b2 appears in the current release, SCOPe 2.08