Lineage for d1yedb2 (1yed B:116-217)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1292198Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
  7. 1292510Species Mouse (Mus musculus) [TaxId:10090] [88576] (414 PDB entries)
    Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form
  8. 1292952Domain d1yedb2: 1yed B:116-217 [21181]
    Other proteins in same PDB: d1yeda1, d1yeda2, d1yedb1, d1yedh1, d1yedl1, d1yedl2
    part of Fab D2.4
    complexed with pnb

Details for d1yedb2

PDB Entry: 1yed (more details), 3.1 Å

PDB Description: structure of a catalytic antibody igg2a fab fragment (d2.4)
PDB Compounds: (B:) igg1 fab fragment (d.2.4)

SCOPe Domain Sequences for d1yedb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yedb2 b.1.1.2 (B:116-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc

SCOPe Domain Coordinates for d1yedb2:

Click to download the PDB-style file with coordinates for d1yedb2.
(The format of our PDB-style files is described here.)

Timeline for d1yedb2: