Lineage for d3ikra1 (3ikr A:204-234)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2265467Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2265468Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) (S)
  5. 2265469Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)
  6. 2265541Protein Surfactant protein [57949] (2 species)
  7. 2265542Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (24 PDB entries)
  8. 2265588Domain d3ikra1: 3ikr A:204-234 [211803]
    Other proteins in same PDB: d3ikra2, d3ikrb2, d3ikrc2
    automated match to d1pwba2
    complexed with ca, man

Details for d3ikra1

PDB Entry: 3ikr (more details), 1.65 Å

PDB Description: crystal structure of alpha 1-4 mannobiose bound trimeric human lung surfactant protein d
PDB Compounds: (A:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d3ikra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ikra1 h.1.1.1 (A:204-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
vaslrqqvealqgqvqhlqaafsqykkvelf

SCOPe Domain Coordinates for d3ikra1:

Click to download the PDB-style file with coordinates for d3ikra1.
(The format of our PDB-style files is described here.)

Timeline for d3ikra1: