Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species) |
Species Fab D2.4 (mouse), kappa L chain [49046] (1 PDB entry) |
Domain d1yeda2: 1yed A:111-222 [21180] Other proteins in same PDB: d1yeda1, d1yedb1, d1yedh1, d1yedl1 |
PDB Entry: 1yed (more details), 3.1 Å
SCOP Domain Sequences for d1yeda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yeda2 b.1.1.2 (A:111-222) Immunoglobulin (constant domains of L and H chains) {Fab D2.4 (mouse), kappa L chain} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1yeda2: