Lineage for d1yedh2 (1yed H:116-217)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655689Domain d1yedh2: 1yed H:116-217 [21179]
    Other proteins in same PDB: d1yeda1, d1yeda2, d1yedb1, d1yedh1, d1yedl1, d1yedl2

Details for d1yedh2

PDB Entry: 1yed (more details), 3.1 Å

PDB Description: structure of a catalytic antibody igg2a fab fragment (d2.4)
PDB Compounds: (H:) igg1 fab fragment (d.2.4)

SCOP Domain Sequences for d1yedh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yedh2 b.1.1.2 (H:116-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc

SCOP Domain Coordinates for d1yedh2:

Click to download the PDB-style file with coordinates for d1yedh2.
(The format of our PDB-style files is described here.)

Timeline for d1yedh2: