SCOPe 2.08: Domain d3ikcc1: 3ikc C:2-106

Lineage for d3ikcc1 (3ikc C:2-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d3ikcc1: 3ikc C:2-106 [211779]
   Other proteins in same PDB: d3ikca2, d3ikcb_, d3ikcc2, d3ikcd_
   automated match to d1c12a1
   complexed with mg

Details for d3ikcc1

PDB Entry: 3ikc, 2.6 Å

PDB Description: structure of s67-27 in complex with kdo(2.8)-7-o-methyl-kdo

PDB Compounds: (C:) Immunoglobulin light chain (IGG3)

SCOPe Domain Sequences for d3ikcc1:

Sequence; same for both SEQRES and ATOM records:

>d3ikcc1 b.1.1.0 (C:2-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ivmtqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastre
sgvpdrftgsgsgtdftltissvqaedlavyyckqsnnlrtfgggtkleik

Timeline for d3ikcc1:

• d3ikcc1 first appeared in SCOPe 2.03
  
• d3ikcc1 appears in SCOPe 2.07