Lineage for d3ikca1 (3ikc A:2-106)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1520466Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)
  8. 1520894Domain d3ikca1: 3ikc A:2-106 [211777]
    Other proteins in same PDB: d3ikca2, d3ikcc2
    automated match to d1c12a1
    complexed with kdo, kme, mg

Details for d3ikca1

PDB Entry: 3ikc (more details), 2.6 Å

PDB Description: Structure of S67-27 in Complex with Kdo(2.8)-7-O-methyl-Kdo
PDB Compounds: (A:) Immunoglubilin light chain (IGG3)

SCOPe Domain Sequences for d3ikca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ikca1 b.1.1.0 (A:2-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ivmtqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastre
sgvpdrftgsgsgtdftltissvqaedlavyyckqsnnlrtfgggtkleik

SCOPe Domain Coordinates for d3ikca1:

Click to download the PDB-style file with coordinates for d3ikca1.
(The format of our PDB-style files is described here.)

Timeline for d3ikca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ikca2