SCOPe 2.06: Domain d3ik9b2: 3ik9 B:81-222

Lineage for d3ik9b2 (3ik9 B:81-222)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (30 PDB entries)
   Uniprot P08263

8. Domain d3ik9b2: 3ik9 B:81-222 [211764]
   Other proteins in same PDB: d3ik9a1, d3ik9b1, d3ik9c1, d3ik9d1, d3ik9e1, d3ik9f1, d3ik9g1, d3ik9h1
   automated match to d1agsa1
   complexed with bob

Details for d3ik9b2

PDB Entry: 3ik9, 2.2 Å

PDB Description: human gst a1-1-gimf with gsdhn

PDB Compounds: (B:) glutathione s-transferase a1

SCOPe Domain Sequences for d3ik9b2:

Sequence; same for both SEQRES and ATOM records:

>d3ik9b2 a.45.1.1 (B:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemiimlpfcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkpppdeiyvrtvynifrp

Timeline for d3ik9b2:

• d3ik9b2 first appeared in SCOPe 2.03
  
• d3ik9b2 appears in SCOPe 2.05
  
• d3ik9b2 appears in SCOPe 2.07
  
• d3ik9b2 appears in the current release, SCOPe 2.08