Lineage for d3ik7b2 (3ik7 B:81-221)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998814Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1998815Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1998816Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1998829Protein Class alpha GST [81349] (8 species)
  7. 1998842Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (30 PDB entries)
    Uniprot P08263
  8. 1998861Domain d3ik7b2: 3ik7 B:81-221 [211756]
    Other proteins in same PDB: d3ik7a1, d3ik7b1, d3ik7c1, d3ik7d1
    automated match to d1gula1
    complexed with bob, so4

Details for d3ik7b2

PDB Entry: 3ik7 (more details), 1.97 Å

PDB Description: human glutathione transferase a4-4 with gsdhn
PDB Compounds: (B:) Glutathione S-transferase A4

SCOPe Domain Sequences for d3ik7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ik7b2 a.45.1.1 (B:81-221) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lfgknlkertlidmyvegtldllellimhpflkpddqqkevvnmaqkaiiryfpvfekil
rghgqsflvgnqlsladvillqtilaleekipnilsafpflqeytvklsniptikrflep
gskkkpppdeiyvrtvynifr

SCOPe Domain Coordinates for d3ik7b2:

Click to download the PDB-style file with coordinates for d3ik7b2.
(The format of our PDB-style files is described here.)

Timeline for d3ik7b2: