SCOPe 2.06: Domain d3ik7a2: 3ik7 A:81-222

Lineage for d3ik7a2 (3ik7 A:81-222)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (30 PDB entries)
   Uniprot P08263

8. Domain d3ik7a2: 3ik7 A:81-222 [211754]
   Other proteins in same PDB: d3ik7a1, d3ik7b1, d3ik7c1, d3ik7d1
   automated match to d1gula1
   complexed with bob, so4

Details for d3ik7a2

PDB Entry: 3ik7, 1.97 Å

PDB Description: human glutathione transferase a4-4 with gsdhn

PDB Compounds: (A:) Glutathione S-transferase A4

SCOPe Domain Sequences for d3ik7a2:

Sequence; same for both SEQRES and ATOM records:

>d3ik7a2 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lfgknlkertlidmyvegtldllellimhpflkpddqqkevvnmaqkaiiryfpvfekil
rghgqsflvgnqlsladvillqtilaleekipnilsafpflqeytvklsniptikrflep
gskkkpppdeiyvrtvynifrp

Timeline for d3ik7a2:

• d3ik7a2 first appeared in SCOPe 2.03
  
• d3ik7a2 appears in SCOPe 2.05
  
• d3ik7a2 appears in SCOPe 2.07
  
• d3ik7a2 appears in the current release, SCOPe 2.08