SCOP 1.55: Domain d1yech2: 1yec H:114-223

Lineage for d1yech2 (1yec H:114-223)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab D2.3 (mouse), kappa L chain [49045] (4 PDB entries)

8. Domain d1yech2: 1yec H:114-223 [21175]
   Other proteins in same PDB: d1yech1, d1yecl1

Details for d1yech2

PDB Entry: 1yec, 1.9 Å

PDB Description: structure of a catalytic antibody igg2a fab fragment (d2.3)

SCOP Domain Sequences for d1yech2:

Sequence; same for both SEQRES and ATOM records:

>d1yech2 b.1.1.2 (H:114-223) Immunoglobulin (constant domains of L and H chains) {Fab D2.3 (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep

Timeline for d1yech2:

• d1yech2 appears in SCOP 1.57
  
• d1yech2 appears in the current release, SCOPe 2.08