Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
Species Fab D2.3 (mouse), kappa L chain [49045] (4 PDB entries) |
Domain d1yech2: 1yec H:114-223 [21175] Other proteins in same PDB: d1yech1, d1yecl1 |
PDB Entry: 1yec (more details), 1.9 Å
SCOP Domain Sequences for d1yech2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yech2 b.1.1.2 (H:114-223) Immunoglobulin (constant domains of L and H chains) {Fab D2.3 (mouse), kappa L chain} akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep
Timeline for d1yech2: