SCOPe 2.05: Domain d3ik4b1: 3ik4 B:0-126

Lineage for d3ik4b1 (3ik4 B:0-126)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (83 species)
   not a true protein

7. Species Herpetosiphon aurantiacus [TaxId:316274] [225737] (1 PDB entry)

8. Domain d3ik4b1: 3ik4 B:0-126 [211747]
   Other proteins in same PDB: d3ik4a2, d3ik4b2, d3ik4c2, d3ik4d2
   automated match to d1jpma2
   complexed with gol, k

Details for d3ik4b1

PDB Entry: 3ik4, 2.1 Å

PDB Description: crystal structure of mandelate racemase/muconate lactonizing protein from herpetosiphon aurantiacus

PDB Compounds: (B:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d3ik4b1:

Sequence; same for both SEQRES and ATOM records:

>d3ik4b1 d.54.1.0 (B:0-126) automated matches {Herpetosiphon aurantiacus [TaxId: 316274]}
slpttiqaisaeainlpltepfaiasgaqavaanvlvkvqladgtlglgeaapfpavsge
tqtgtsaaierlqshllgadvrgwrklaamldhaeheaaaarcglemamldaltrhyhmp
lhvffgg

Timeline for d3ik4b1:

• d3ik4b1 first appeared in SCOPe 2.03
  
• d3ik4b1 appears in SCOPe 2.04
  
• d3ik4b1 appears in SCOPe 2.06
  
• d3ik4b1 appears in the current release, SCOPe 2.08