SCOPe 2.07: Domain d3ijya2: 3ijy A:107-210

Lineage for d3ijya2 (3ijy A:107-210)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d3ijya2: 3ijy A:107-210 [211742]
   Other proteins in same PDB: d3ijya1, d3ijyc1
   automated match to d1dqdl2
   complexed with mg

Details for d3ijya2

PDB Entry: 3ijy, 2.85 Å

PDB Description: structure of s67-27 in complex with kdo(2.8)kdo

PDB Compounds: (A:) Immunoglubilin light chain (IGG3)

SCOPe Domain Sequences for d3ijya2:

Sequence; same for both SEQRES and ATOM records:

>d3ijya2 b.1.1.2 (A:107-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d3ijya2:

• d3ijya2 first appeared in SCOPe 2.03
  
• d3ijya2 appears in SCOPe 2.06
  
• d3ijya2 appears in the current release, SCOPe 2.08