Lineage for d3ijya1 (3ijy A:2-106)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1296776Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)
  8. 1297180Domain d3ijya1: 3ijy A:2-106 [211741]
    Other proteins in same PDB: d3ijya2, d3ijyc2
    automated match to d1dqdl1
    complexed with mg

Details for d3ijya1

PDB Entry: 3ijy (more details), 2.85 Å

PDB Description: Structure of S67-27 in Complex with Kdo(2.8)Kdo
PDB Compounds: (A:) Immunoglubilin light chain (IGG3)

SCOPe Domain Sequences for d3ijya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ijya1 b.1.1.0 (A:2-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ivmtqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastre
sgvpdrftgsgsgtdftltissvqaedlavyyckqsnnlrtfgggtkleik

SCOPe Domain Coordinates for d3ijya1:

Click to download the PDB-style file with coordinates for d3ijya1.
(The format of our PDB-style files is described here.)

Timeline for d3ijya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ijya2