Lineage for d3ijsa2 (3ijs A:107-212)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2363630Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)
  8. 2364031Domain d3ijsa2: 3ijs A:107-212 [211736]
    Other proteins in same PDB: d3ijsa1, d3ijsc1
    automated match to d1dqdl2
    complexed with mg

Details for d3ijsa2

PDB Entry: 3ijs (more details), 2.55 Å

PDB Description: structure of s67-27 in complex with tsbp
PDB Compounds: (A:) Immunoglubilin light chain (IGG3)

SCOPe Domain Sequences for d3ijsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ijsa2 b.1.1.2 (A:107-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d3ijsa2:

Click to download the PDB-style file with coordinates for d3ijsa2.
(The format of our PDB-style files is described here.)

Timeline for d3ijsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ijsa1