Lineage for d3ijrh_ (3ijr H:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1830652Species Bacillus anthracis [TaxId:261594] [196544] (4 PDB entries)
  8. 1830666Domain d3ijrh_: 3ijr H: [211734]
    automated match to d1g0oc_
    complexed with mg, nad, so4

Details for d3ijrh_

PDB Entry: 3ijr (more details), 2.05 Å

PDB Description: 2.05 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'ames ancestor' in complex with nad+
PDB Compounds: (H:) Oxidoreductase, short chain dehydrogenase/reductase family

SCOPe Domain Sequences for d3ijrh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ijrh_ c.2.1.0 (H:) automated matches {Bacillus anthracis [TaxId: 261594]}
ampqqknfvtmpaqhqnkqpgieslmnplpqfedpnykgseklkgknvlitggdsgigra
vsiafakeganiaiayldeegdanetkqyvekegvkcvllpgdlsdeqhckdivqetvrq
lgslnilvnnvaqqypqqgleyitaeqlektfrinifsyfhvtkaalshlkqgdviinta
sivayegnetlidysatkgaivaftrslsqslvqkgirvngvapgpiwtplipssfdekk
vsqfgsnvpmqrpgqpyelapayvylassdssyvtgqmihvnggvivng

SCOPe Domain Coordinates for d3ijrh_:

Click to download the PDB-style file with coordinates for d3ijrh_.
(The format of our PDB-style files is described here.)

Timeline for d3ijrh_: