SCOPe 2.08: Domain d3ij6b1: 3ij6 B:3-304

Lineage for d3ij6b1 (3ij6 B:3-304)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.0: automated matches [191327] (1 protein)
   not a true family

6. Protein automated matches [190150] (36 species)
   not a true protein

7. Species Lactobacillus acidophilus [TaxId:1579] [225736] (1 PDB entry)

8. Domain d3ij6b1: 3ij6 B:3-304 [211714]
   Other proteins in same PDB: d3ij6a2, d3ij6b2, d3ij6c2, d3ij6d2
   automated match to d2f6ka1
   complexed with na, zn

Details for d3ij6b1

PDB Entry: 3ij6, 2 Å

PDB Description: crystal structure of an uncharacterized metal-dependent hydrolase from lactobacillus acidophilus

PDB Compounds: (B:) uncharacterized metal-dependent hydrolase

SCOPe Domain Sequences for d3ij6b1:

Sequence; same for both SEQRES and ATOM records:

>d3ij6b1 c.1.9.0 (B:3-304) automated matches {Lactobacillus acidophilus [TaxId: 1579]}
tkidayahilpakyyqkmlsvepnipnmfpfikiktlmdlderltkwpdqntkqvislan
ispedftdsktsaelcqsaneelsnlvdqhpgkfagavailpmnniesackvissikdde
nlvgaqiftrhlgksiadkefrpvlaqaaklhvplwmhpvfdarkpdnnlvfsweyelsq
amlqlvqsdlfqdypnlkilvhhagamvpffsgridhildekhaqdfkkfyvdtailgnt
palqlaidyygidhvlfgtdapfavmpsgadqiitqaindltisdkdkqkifhdnyysli
ke

Timeline for d3ij6b1:

• d3ij6b1 first appeared in SCOPe 2.03, called d3ij6b_
  
• d3ij6b1 appears in SCOPe 2.07