Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (6 families) has extra strand located between strands 2 and 3 |
Family c.72.1.0: automated matches [191321] (1 protein) not a true family |
Protein automated matches [190117] (50 species) not a true protein |
Species Pyrococcus horikoshii [TaxId:53953] [225557] (2 PDB entries) |
Domain d3ih0b1: 3ih0 B:4-305 [211684] Other proteins in same PDB: d3ih0a2, d3ih0b2 automated match to d2fv7a1 complexed with anp, gol |
PDB Entry: 3ih0 (more details), 1.9 Å
SCOPe Domain Sequences for d3ih0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ih0b1 c.72.1.0 (B:4-305) automated matches {Pyrococcus horikoshii [TaxId: 53953]} iasigellidlisveegdlkdvrlfekhpggapanvavgvsrlgvkssliskvgndpfge ylieelskenvdtrgivkdekkhtgivfvqlkgaspsfllyddvayfnmtlndinwdive eakivnfgsvilarnpsretvmkvikkikgssliafdvnlrldlwrgqeeemikvleesi kladivkaseeevlylenqgvevkgsmltaitlgpkgfrliknetvvdvpsynvnpldtt gagdafmaallvgilklkgldllklgkfanlvaalstqkrgawstprkdellkykearev la
Timeline for d3ih0b1: