![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily) oligomeric transmembrane alpha-helical proteins |
![]() | Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families) ![]() |
![]() | Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
![]() | Protein Potassium channel protein [56901] (2 species) |
![]() | Species Streptomyces lividans [TaxId:1916] [161074] (20 PDB entries) |
![]() | Domain d3igac_: 3iga C: [211678] Other proteins in same PDB: d3igaa1, d3igaa2, d3igab1, d3igab2 automated match to d1r3jc_ complexed with dga, ni |
PDB Entry: 3iga (more details), 2.75 Å
SCOPe Domain Sequences for d3igac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3igac_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans [TaxId: 1916]} salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh
Timeline for d3igac_:
![]() Domains from other chains: (mouse over for more information) d3igaa1, d3igaa2, d3igab1, d3igab2 |