SCOPe 2.04: Domain d3ig1a2: 3ig1 A:430-554

Lineage for d3ig1a2 (3ig1 A:430-554)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (26 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 bh10 [TaxId:11678] [225195] (14 PDB entries)

8. Domain d3ig1a2: 3ig1 A:430-554 [211672]
   Other proteins in same PDB: d3ig1a1, d3ig1b_
   automated match to d1bqna1
   protein/DNA complex; protein/RNA complex; complexed with jth, mn

Details for d3ig1a2

PDB Entry: 3ig1, 2.8 Å

PDB Description: hiv-1 reverse transcriptase with the inhibitor beta-thujaplicinol bound at the rnase h active site

PDB Compounds: (A:) hiv-1 reverse transcriptase p66 subunit

SCOPe Domain Sequences for d3ig1a2:

Sequence; same for both SEQRES and ATOM records:

>d3ig1a2 c.55.3.0 (A:430-554) automated matches {Human immunodeficiency virus type 1 bh10 [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsa

Timeline for d3ig1a2:

• d3ig1a2 first appeared in SCOPe 2.03
  
• d3ig1a2 appears in SCOPe 2.05
  
• d3ig1a2 appears in the current release, SCOPe 2.08