SCOPe 2.08: Domain d3ifvb1: 3ifv B:2-112

Lineage for d3ifvb1 (3ifv B:2-112)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
   duplication: consists of two domains of this fold

6. Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species)

7. Species Haloferax volcanii [TaxId:2246] [225733] (1 PDB entry)

8. Domain d3ifvb1: 3ifv B:2-112 [211666]
   automated match to d1ge8a1
   complexed with na

Details for d3ifvb1

PDB Entry: 3ifv, 2 Å

PDB Description: crystal structure of the haloferax volcanii proliferating cell nuclear antigen

PDB Compounds: (B:) pcna

SCOPe Domain Sequences for d3ifvb1:

Sequence, based on SEQRES records:

>d3ifvb1 d.131.1.2 (B:2-112) Proliferating cell nuclear antigen (PCNA) {Haloferax volcanii [TaxId: 2246]}
fkaivsaatlrdaldsvsvlvdeckirlneeslsiravdpanvgmvdltldaaafesyea
hggvigvnlsrleevagmagagdlihltldeetrklniridglsytlalid

Sequence, based on observed residues (ATOM records):

>d3ifvb1 d.131.1.2 (B:2-112) Proliferating cell nuclear antigen (PCNA) {Haloferax volcanii [TaxId: 2246]}
fkaivsaatlrdaldsvsvlvdeckirlneeslsiravdpanvgmvdltldaaafesyea
hggvigvnlsrleevagmagagdlihltlklniridglsytlalid

Timeline for d3ifvb1:

• d3ifvb1 first appeared in SCOPe 2.03
  
• d3ifvb1 appears in SCOPe 2.07