SCOPe 2.06: Domain d3ifh51: 3ifh 5:5-484

Lineage for d3ifh51 (3ifh 5:5-484)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.82: ALDH-like [53719] (1 superfamily)
   consists of two similar domains with 3 layers (a/b/a) each; duplication
   core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.82.1: ALDH-like [53720] (3 families)
   binds NAD differently from other NAD(P)-dependent oxidoreductases

5. Family c.82.1.0: automated matches [191448] (1 protein)
   not a true family

6. Protein automated matches [190683] (49 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:320372] [225734] (2 PDB entries)

8. Domain d3ifh51: 3ifh 5:5-484 [211650]
   Other proteins in same PDB: d3ifh12, d3ifh22, d3ifh32, d3ifh42, d3ifh52, d3ifh62, d3ifhq2, d3ifhr2, d3ifhs2, d3ifht2, d3ifhu2, d3ifhv2, d3ifhw2, d3ifhx2, d3ifhy2, d3ifhz2

Details for d3ifh51

PDB Entry: 3ifh, 2.7 Å

PDB Description: Crystal structure of succinate-semialdehyde dehydrogenase from Burkholderia pseudomallei, part 2 of 2

PDB Compounds: (5:) Succinate-semialdehyde dehydrogenase (NADP+)

SCOPe Domain Sequences for d3ifh51:

Sequence; same for both SEQRES and ATOM records:

>d3ifh51 c.82.1.0 (5:5-484) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
mkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaawa
gwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfaee
gkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvkpa
estpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrllm
aqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvhervy
dafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkrha
lghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylysrd
igrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcvav

Timeline for d3ifh51:

• d3ifh51 first appeared in SCOPe 2.03, called d3ifh5_
  
• d3ifh51 was called d3ifh5_ in SCOPe 2.05
  
• d3ifh51 appears in SCOPe 2.07
  
• d3ifh51 appears in the current release, SCOPe 2.08