SCOP 1.57: Domain d1mpah2: 1mpa H:122-225

Lineage for d1mpah2 (1mpa H:122-225)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)

7. Species Bactericidal Fab (mouse), kappa L chain [49042] (1 PDB entry)

8. Domain d1mpah2: 1mpa H:122-225 [21165]
   Other proteins in same PDB: d1mpah1, d1mpal1

Details for d1mpah2

PDB Entry: 1mpa, 2.6 Å

PDB Description: bactericidal antibody against neisseria meningitidis

SCOP Domain Sequences for d1mpah2:

Sequence; same for both SEQRES and ATOM records:

>d1mpah2 b.1.1.2 (H:122-225) Immunoglobulin (constant domains of L and H chains) {Bactericidal Fab (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgpti

Timeline for d1mpah2:

• d1mpah2 first appeared (with stable ids) in SCOP 1.55
  
• d1mpah2 appears in SCOP 1.59
  
• d1mpah2 appears in the current release, SCOPe 2.08