![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries) |
![]() | Domain d1mpal2: 1mpa L:113-219 [21164] Other proteins in same PDB: d1mpah1, d1mpah2, d1mpal1 part of bactericidal Fab MN12H2 against Neisseria meningitidis complexed with cd, cyf, thc |
PDB Entry: 1mpa (more details), 2.6 Å
SCOP Domain Sequences for d1mpal2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mpal2 b.1.1.2 (L:113-219) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1mpal2: