Lineage for d3ifgc_ (3ifg C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1875571Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 1875572Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 1875981Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 1875982Protein automated matches [190683] (38 species)
    not a true protein
  7. 1876095Species Burkholderia pseudomallei [TaxId:320372] [225734] (2 PDB entries)
  8. 1876098Domain d3ifgc_: 3ifg C: [211632]

Details for d3ifgc_

PDB Entry: 3ifg (more details), 2.7 Å

PDB Description: Crystal structure of succinate-semialdehyde dehydrogenase from Burkholderia pseudomallei, part 1 of 2
PDB Compounds: (C:) Succinate-semialdehyde dehydrogenase (NADP+)

SCOPe Domain Sequences for d3ifgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ifgc_ c.82.1.0 (C:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
gsmkdpsllrhqayiggewqaadsdatfevfdpatgeslgtvpkmgaaetaraieaaqaa
wagwrmktakeraailrrwfdlviansddlaliltteqgkplaeakgeiayaasfiewfa
eegkrvagdtlptpdankrivvvkepigvcaaitpwnfpaamiarkvgpalaagcpivvk
paestpfsalamaflaeragvpkgvlsvvigdpkaigteitsnpivrklsftgstavgrl
lmaqsaptvkkltlelggnapfivfddadldaavegaiaskyrnngqtcvctnrffvher
vydafadklaaavsklkvgrgtesgatlgplineaavkkveshiadalakgaslmtggkr
halghgffeptvltgvkpdmdvakeetfgplaplfrfaseeelvrlandtefglaaylys
rdigrvwrvaealeygmvgintglisnevapfggvkqsglgregshygiddyvvikylcv
av

SCOPe Domain Coordinates for d3ifgc_:

Click to download the PDB-style file with coordinates for d3ifgc_.
(The format of our PDB-style files is described here.)

Timeline for d3ifgc_: