Lineage for d3if1c2 (3if1 C:113-212)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1520466Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)
  8. 1520803Domain d3if1c2: 3if1 C:113-212 [211626]
    Other proteins in same PDB: d3if1a1, d3if1c1
    automated match to d1a4ka2
    complexed with mg, nga, zn

Details for d3if1c2

PDB Entry: 3if1 (more details), 2.39 Å

PDB Description: crystal structure of 237mab in complex with a galnac
PDB Compounds: (C:) Immunoglobulin light chain (IgG2a)

SCOPe Domain Sequences for d3if1c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3if1c2 b.1.1.0 (C:113-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdst
ysmsstltltkdeyerhnsytceathktstspivksfnre

SCOPe Domain Coordinates for d3if1c2:

Click to download the PDB-style file with coordinates for d3if1c2.
(The format of our PDB-style files is described here.)

Timeline for d3if1c2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3if1c1