Lineage for d3if1c1 (3if1 C:2-112)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1512732Protein automated matches [190119] (19 species)
    not a true protein
  7. 1513189Species Mouse (Mus musculus) [TaxId:10090] [186842] (122 PDB entries)
  8. 1513303Domain d3if1c1: 3if1 C:2-112 [211625]
    Other proteins in same PDB: d3if1a2, d3if1c2
    automated match to d1a4ka1
    complexed with mg, nga, zn

Details for d3if1c1

PDB Entry: 3if1 (more details), 2.39 Å

PDB Description: crystal structure of 237mab in complex with a galnac
PDB Compounds: (C:) Immunoglobulin light chain (IgG2a)

SCOPe Domain Sequences for d3if1c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3if1c1 b.1.1.1 (C:2-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqltqsplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrfs
gvpdrfsgsgsgtdftlkissveaedlgvyfcsqsthvptfgggtkleikradaa

SCOPe Domain Coordinates for d3if1c1:

Click to download the PDB-style file with coordinates for d3if1c1.
(The format of our PDB-style files is described here.)

Timeline for d3if1c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3if1c2