Lineage for d1afvm2 (1afv M:113-217)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 103934Species Fab 25.3 (mouse), kappa L chain [49041] (1 PDB entry)
  8. 103938Domain d1afvm2: 1afv M:113-217 [21162]
    Other proteins in same PDB: d1afva_, d1afvb_, d1afvh1, d1afvk1, d1afvl1, d1afvm1

Details for d1afvm2

PDB Entry: 1afv (more details), 3.7 Å

PDB Description: hiv-1 capsid protein (p24) complex with fab25.3

SCOP Domain Sequences for d1afvm2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1afvm2 b.1.1.2 (M:113-217) Immunoglobulin (constant domains of L and H chains) {Fab 25.3 (mouse), kappa L chain}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOP Domain Coordinates for d1afvm2:

Click to download the PDB-style file with coordinates for d1afvm2.
(The format of our PDB-style files is described here.)

Timeline for d1afvm2: