SCOPe 2.07: Domain d3ieua1: 3ieu A:4-182

Lineage for d3ieua1 (3ieu A:4-182)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (80 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein GTPase Era, N-terminal domain [52637] (3 species)

7. Species Escherichia coli K-12 [TaxId:83333] [224886] (1 PDB entry)

8. Domain d3ieua1: 3ieu A:4-182 [211617]
   Other proteins in same PDB: d3ieua2, d3ieub2
   automated match to d1egab1
   protein/RNA complex; complexed with gdp, so4, trs

Details for d3ieua1

PDB Entry: 3ieu, 2.8 Å

PDB Description: crystal structure of era in complex with gdp

PDB Compounds: (A:) GTP-binding protein era

SCOPe Domain Sequences for d3ieua1:

Sequence; same for both SEQRES and ATOM records:

>d3ieua1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli K-12 [TaxId: 83333]}
dksycgfiaivgrpnvgkstllnkllgqkisitsrkaqttrhrivgihtegayqaiyvdt
pglhmeekrainrlmnkaasssigdvelvifvvegtrwtpddemvlnklregkapvilav
nkvdnvqekadllphlqflasqmnfldivpisaetglnvdtiaaivrkhlpeathhfpe

Timeline for d3ieua1:

• d3ieua1 first appeared in SCOPe 2.03
  
• d3ieua1 appears in SCOPe 2.06
  
• d3ieua1 appears in the current release, SCOPe 2.08