Lineage for d3ieif_ (3iei F:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1378488Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1378489Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1379620Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 1379621Protein automated matches [190689] (42 species)
    not a true protein
  7. 1379711Species Human (Homo sapiens) [TaxId:9606] [187871] (6 PDB entries)
  8. 1379717Domain d3ieif_: 3iei F: [211610]
    automated match to d1rjdb_
    complexed with gol, mes, sah

Details for d3ieif_

PDB Entry: 3iei (more details), 1.9 Å

PDB Description: crystal structure of human leucine carboxylmethyltransferase-1 in complex with s-adenosyl homocysteine
PDB Compounds: (F:) Leucine carboxyl methyltransferase 1

SCOPe Domain Sequences for d3ieif_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ieif_ c.66.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvrgtcedaslckrfavsigywhdpyiqhfvrlskerkapeinrgyfarvhgvsqlikaf
lrktechcqivnlgagmdttfwrlkdedllsskyfevdfpmivtrklhsikckpplsspi
lelhsedtlqmdghildskryavigadlrdlseleeklkkcnmntqlptlliaecvlvym
tpeqsanllkwaansferamfinyeqvnmgdrfgqimienlrrrqcdlagvetckslesq
kerllsngwetasavdmmelynrlpraevsrieslefldemelleqlmrhyclcwatkgg
nelglkeity

SCOPe Domain Coordinates for d3ieif_:

Click to download the PDB-style file with coordinates for d3ieif_.
(The format of our PDB-style files is described here.)

Timeline for d3ieif_: