Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species) |
Species Fab 25.3 (mouse), kappa L chain [49041] (1 PDB entry) |
Domain d1afvh2: 1afv H:121-220 [21161] Other proteins in same PDB: d1afva_, d1afvb_, d1afvh1, d1afvk1, d1afvl1, d1afvm1 |
PDB Entry: 1afv (more details), 3.7 Å
SCOP Domain Sequences for d1afvh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1afvh2 b.1.1.2 (H:121-220) Immunoglobulin (constant domains of L and H chains) {Fab 25.3 (mouse), kappa L chain} akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpk
Timeline for d1afvh2: