Lineage for d1afvh2 (1afv H:121-220)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747669Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 2747968Species Mouse (Mus musculus) [TaxId:10090] [88576] (391 PDB entries)
    Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form
  8. 2748382Domain d1afvh2: 1afv H:121-220 [21161]
    Other proteins in same PDB: d1afva_, d1afvb_, d1afvh1, d1afvk1, d1afvl1, d1afvl2, d1afvm1, d1afvm2
    part of Fab 25.3 against HIV-1 capsid protein (p24)
    complexed with pb

Details for d1afvh2

PDB Entry: 1afv (more details), 3.7 Å

PDB Description: hiv-1 capsid protein (p24) complex with fab25.3
PDB Compounds: (H:) antibody fab25.3 fragment (heavy chain)

SCOPe Domain Sequences for d1afvh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1afvh2 b.1.1.2 (H:121-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpk

SCOPe Domain Coordinates for d1afvh2:

Click to download the PDB-style file with coordinates for d1afvh2.
(The format of our PDB-style files is described here.)

Timeline for d1afvh2: