Lineage for d3ie3b2 (3ie3 B:79-209)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713204Protein Class pi GST [81347] (4 species)
  7. 2713205Species Human (Homo sapiens) [TaxId:9606] [47619] (67 PDB entries)
  8. 2713256Domain d3ie3b2: 3ie3 B:79-209 [211601]
    Other proteins in same PDB: d3ie3a1, d3ie3b1
    automated match to d1gssa1
    complexed with gsh, mes, n11

Details for d3ie3b2

PDB Entry: 3ie3 (more details), 1.8 Å

PDB Description: structural basis for the binding of the anti-cancer compound 6-(7- nitro-2,1,3-benzoxadiazol-4-ylthio)hexanol (nbdhex) to human glutathione s-transferases
PDB Compounds: (B:) Glutathione S-transferase P

SCOPe Domain Sequences for d3ie3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ie3b2 a.45.1.1 (B:79-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
ygkdqqeaalvdmvndgvedlrckyasliytnyeagkddyvkalpgqlkpfetllsqnqg
gktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflaspey
vnlpingngkq

SCOPe Domain Coordinates for d3ie3b2:

Click to download the PDB-style file with coordinates for d3ie3b2.
(The format of our PDB-style files is described here.)

Timeline for d3ie3b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ie3b1