SCOP 1.61: Domain d1mimh2: 1mim H:116-215

Lineage for d1mimh2 (1mim H:116-215)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Fab CHI621 (mouse), kappa L chain [49040] (1 PDB entry)

8. Domain d1mimh2: 1mim H:116-215 [21159]
   Other proteins in same PDB: d1mimh1, d1miml1

Details for d1mimh2

PDB Entry: 1mim, 2.6 Å

PDB Description: igg fab fragment (cd25-binding)

SCOP Domain Sequences for d1mimh2:

Sequence; same for both SEQRES and ATOM records:

>d1mimh2 b.1.1.2 (H:116-215) Immunoglobulin (constant domains of L and H chains) {Fab CHI621 (mouse), kappa L chain}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep

Timeline for d1mimh2:

• d1mimh2 first appeared (with stable ids) in SCOP 1.55
  
• d1mimh2 appears in SCOP 1.59
  
• d1mimh2 appears in SCOP 1.63
  
• d1mimh2 appears in the current release, SCOPe 2.08