SCOPe 2.06: Domain d3idna2: 3idn A:108-214

Lineage for d3idna2 (3idn A:108-214)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d3idna2: 3idn A:108-214 [211587]
   Other proteins in same PDB: d3idna1
   automated match to d2f5bl2

Details for d3idna2

PDB Entry: 3idn, 2.25 Å

PDB Description: crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 fab' fragment in complex with gp41 peptide analog eld(paf)was

PDB Compounds: (A:) 2F5 Fab light chain

SCOPe Domain Sequences for d3idna2:

Sequence; same for both SEQRES and ATOM records:

>d3idna2 b.1.1.2 (A:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyecevthqglsspvtksfnrgec

Timeline for d3idna2:

• d3idna2 first appeared in SCOPe 2.03
  
• d3idna2 appears in SCOPe 2.05
  
• d3idna2 appears in SCOPe 2.07
  
• d3idna2 appears in the current release, SCOPe 2.08