Lineage for d3idna1 (3idn A:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740697Species Engineered (including hybrid species) [88533] (60 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # Humanized antibody ! SQ NA # humanized antibody ! SQ NA # engineered antibody
  8. 2740744Domain d3idna1: 3idn A:1-107 [211586]
    Other proteins in same PDB: d3idna2
    automated match to d2f5bl1

Details for d3idna1

PDB Entry: 3idn (more details), 2.25 Å

PDB Description: crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 fab' fragment in complex with gp41 peptide analog eld(paf)was
PDB Compounds: (A:) 2F5 Fab light chain

SCOPe Domain Sequences for d3idna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3idna1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
alqltqspsslsasvgdrititcrasqgvtsalawyrqkpgsppqlliydasslesgvps
rfsgsgsgteftltistlrpedfatyycqqlhfyphtfgggtrvdvr

SCOPe Domain Coordinates for d3idna1:

Click to download the PDB-style file with coordinates for d3idna1.
(The format of our PDB-style files is described here.)

Timeline for d3idna1: